尊敬的 微信汇率:1円 ≈ 0.046166 元 支付宝汇率:1円 ≈ 0.046257元 [退出登录]
SlideShare a Scribd company logo
Unit-8
Software Maintenance
and Configuration
Management
Types of Maintenance
•Corrective Maintenance (21%)
• making changes to repair defects
•Adaptive Maintenance (25%)
• making changes to adapt software to external environment
changes (hardware, business rules, OS, etc.)
•Perfective Maintenance (50%)
• extending system beyond its original functional requirements
•Preventative Maintenance (4%)
• modifying work products so that they are more easily corrected,
adapted, or enhanced
Maintenance Costs
•Usually greater than the development costs (2
to 10 times as much in some cases)
•Affected by both technical and non-technical
factors
•Increase as software is maintained and system
corruption is introduced
•Aging software can have high support costs (e.g.
old languages, compilers, etc.)
Maintenance Developer Tasks
• Understand system.
• Locate information in documentation.
• Keep system documentation up to date.
• Extend existing functions.
• Add new functions.
• Find sources of errors.
• Correct system errors.
• Answer operations questions.
• Restructure design and code.
• Delete obsolete design and code.
• Manage changes.
Maintenance Cost Factors
•Staff turnover
• no turnover usually means lower maintenance costs
•Contractual responsibility
• developers may have no contractual obligation to maintain the
delivered system and no incentive to design for future change
•Staff skills
• maintenance staff are often inexperienced and have limited
domain knowledge
•Program age and structure
• as programs age their structure deteriorates, they become harder
to understand and change
Maintenance Prediction
•Concerned with determining which parts of the
system may cause problems and have high
maintenance costs
•Change acceptance depends on the
maintainability of the components affected by the
change
•Implementing changes degrade system and
reduces its maintainability
•Maintenance costs depends on number of
changes
Configuration Management
•Software changes are inevitable
•One goal of software engineering is to improve how easy
it is to change software
•Configuration management is all about change control.
•Every software engineer has to be concerned with how
changes made to work products are tracked and
propagated throughout a project.
•To ensure quality is maintained the change process must
be audited.
Configuration Management
Definition:
The set of activities that have been developed to
manage change throughout the software life
cycle.
Purpose:
Systematically control changes to the
configuration and maintain the integrity and
traceability of the configuration throughout the
system’s life cycle.
Purpose of CM
• Identify Change
• Control Change
• Ensure Change is Properly Implemented
• Report Changes to All the people who need to
Know
Baseline
•Definition: Specification or product that
• has been formally reviewed and agreed upon,
• serves as the basis for further development, and
• can be changed only through formal change control procedures.
•Signals a point of departure from one activity to the start
of another activity.
•Helps control change without impeding justifiable change.
Project Baseline
•Central repository of reviewed and approved
artifacts that represent a given stable point
in overall system development.
•Shared DB for project and kept in consistent
state.
•Policies allow the team to achieve consistent
state and manage the project.
Software Configuration Item (SCI)
•Definition: Information that is created as part of the
software engineering process.
•Examples:
•Software Project Plan
•Software Requirements Specification
• Models, Prototypes, Requirements
•Design document
• Protocols, Hierarchy Graphs
•Source code
• Modules
•Test suite
•Software tools (e.g., compilers)
Elements of SCM
There are four elements of SCM:
1. Software Configuration Identification
2. Software Configuration Control
3. Software Configuration Auditing
4. Software Configuration Status Accounting
SCM Tasks
•Identification
•Change control
•Version control
•Configuration auditing
•Status reporting
Identification Task
• Identification separately names each CSCI and then organizes it in
the SCM repository using an object-oriented approach
• Objects start out as basic objects and are then grouped into
aggregate objects
• Each object has a set of distinct features that identify it
• A name that is unambiguous to all other objects
• A description that contains the CSCI type, a project identifier,
and change and/or version information
• List of resources needed by the object
• The object realization (i.e., the document, the file, the model,
etc.)
Change Control Task
• Change control is a procedural activity that ensures quality and consistency as
changes are made to a configuration object
• A change request is submitted to a configuration control authority, which is usually a
change control board (CCB)
• The request is evaluated for technical merit, potential side effects, overall impact on other
configuration objects and system functions, and projected cost in terms of money, time, and
resources
• An engineering change order (ECO) is issued for each approved change request
• Describes the change to be made, the constraints to follow, and the criteria for review and
audit
• The baselined CSCI is obtained from the SCM repository
• Access control governs which software engineers have the authority to access and modify a
particular configuration object
• Synchronization control helps to ensure that parallel changes performed by two different
people don't overwrite one another
Version Control Task
• Version control is a set of procedures and tools for managing the
creation and use of multiple occurrences of objects in the SCM
repository
• Required version control capabilities
• An SCM repository that stores all relevant configuration objects
• A version management capability that stores all versions of a configuration
object (or enables any version to be constructed using differences from past
versions)
• A make facility that enables the software engineer to collect all relevant
configuration objects and construct a specific version of the software
• Issues tracking (bug tracking) capability that enables the team to record and
track the status of all outstanding issues associated with each configuration
object
• The SCM repository maintains a change set
• Serves as a collection of all changes made to a baseline configuration
• Used to create a specific version of the software
• Captures all changes to all files in the configuration along with the reason for
changes and details of who made the changes and when
Configuration Auditing Task
• Configuration auditing is an SQA activity that helps to ensure that quality is
maintained as changes are made
• It complements the formal technical review and is conducted by the SQA group
• It addresses the following questions
• Has a formal technical review been conducted to assess technical correctness?
• Has the software process been followed, and have software engineering standards been
properly applied?
• Has the change been "highlighted" and "documented" in the CSCI? Have the change
data and change author been specified? Do the attributes of the configuration object
reflect the change?
• Have SCM procedures for noting the change, recording it, and reporting it been
followed?
• Have all related CSCIs been properly updated?
• A configuration audit ensures that
• The correct CSCIs (by version) have been incorporated into a specific build
• That all documentation is up-to-date and consistent with the version that has been built
Status Reporting Task
• Configuration status reporting (CSR) is also called status
accounting
• Provides information about each change to those personnel in an
organization with a need to know
• Answers what happened, who did it, when did it happen, and
what else will be affected?
• Sources of entries for configuration status reporting
• Each time a CSCI is assigned new or updated information
• Each time a configuration audit is conducted
• The configuration status report
• Placed in an on-line database or on a website for software developers and
maintainers to read
• Given to management and practitioners to keep them appraised of
important changes to the project CSCIs
Software Configuration Auditing

More Related Content

What's hot

Software Evolution and Maintenance Models
Software Evolution and Maintenance ModelsSoftware Evolution and Maintenance Models
Software Evolution and Maintenance Models
Moutasm Tamimi
 
Prototype Model
Prototype ModelPrototype Model
Prototype Model
AIJAZAHMADBAHAR
 
Software maintenance Unit5
Software maintenance  Unit5Software maintenance  Unit5
Software maintenance Unit5
Mohammad Faizan
 
Software Engineering Process Models
Software Engineering Process Models Software Engineering Process Models
Software Engineering Process Models
Satya P. Joshi
 
Agile development, software engineering
Agile development, software engineeringAgile development, software engineering
Agile development, software engineering
Rupesh Vaishnav
 
Process model in SE
Process model in SEProcess model in SE
Process model in SE
suranisaunak
 
Software maintenance
Software maintenanceSoftware maintenance
Software maintenance
Indu Sharma Bhardwaj
 
Software Project Management (monitoring and control)
Software Project Management (monitoring and control)Software Project Management (monitoring and control)
Software Project Management (monitoring and control)
IsrarDewan
 
Software maintenance
Software maintenanceSoftware maintenance
Software maintenance
NancyBeaulah_R
 
software configuration management
software configuration managementsoftware configuration management
software configuration management
Fáber D. Giraldo
 
Slides chapter 2
Slides chapter 2Slides chapter 2
Slides chapter 2
Priyanka Shetty
 
Extreme programming (xp)
Extreme programming (xp)Extreme programming (xp)
Extreme programming (xp)
Mohamed Abdelrahman
 
Evolutionary process models se.ppt
Evolutionary process models se.pptEvolutionary process models se.ppt
Evolutionary process models se.ppt
bhadjaashvini1
 
Function Point Analysis
Function Point AnalysisFunction Point Analysis
Function Point Analysis
Araf Karsh Hamid
 
Spiral model
Spiral modelSpiral model
Spiral model
Noraphyusin
 
Process Improvement in Software Engineering SE25
Process Improvement in Software Engineering SE25Process Improvement in Software Engineering SE25
Process Improvement in Software Engineering SE25
koolkampus
 
Chapter 7 software reliability
Chapter 7 software reliabilityChapter 7 software reliability
Chapter 7 software reliability
despicable me
 
Software Evolution
Software EvolutionSoftware Evolution
Software Evolution
Muhammad Asim
 
Software Metrics - Software Engineering
Software Metrics - Software EngineeringSoftware Metrics - Software Engineering
Software Metrics - Software Engineering
Drishti Bhalla
 
Introduction To Software Configuration Management
Introduction To Software Configuration ManagementIntroduction To Software Configuration Management
Introduction To Software Configuration Management
Rajesh Kumar
 

What's hot (20)

Software Evolution and Maintenance Models
Software Evolution and Maintenance ModelsSoftware Evolution and Maintenance Models
Software Evolution and Maintenance Models
 
Prototype Model
Prototype ModelPrototype Model
Prototype Model
 
Software maintenance Unit5
Software maintenance  Unit5Software maintenance  Unit5
Software maintenance Unit5
 
Software Engineering Process Models
Software Engineering Process Models Software Engineering Process Models
Software Engineering Process Models
 
Agile development, software engineering
Agile development, software engineeringAgile development, software engineering
Agile development, software engineering
 
Process model in SE
Process model in SEProcess model in SE
Process model in SE
 
Software maintenance
Software maintenanceSoftware maintenance
Software maintenance
 
Software Project Management (monitoring and control)
Software Project Management (monitoring and control)Software Project Management (monitoring and control)
Software Project Management (monitoring and control)
 
Software maintenance
Software maintenanceSoftware maintenance
Software maintenance
 
software configuration management
software configuration managementsoftware configuration management
software configuration management
 
Slides chapter 2
Slides chapter 2Slides chapter 2
Slides chapter 2
 
Extreme programming (xp)
Extreme programming (xp)Extreme programming (xp)
Extreme programming (xp)
 
Evolutionary process models se.ppt
Evolutionary process models se.pptEvolutionary process models se.ppt
Evolutionary process models se.ppt
 
Function Point Analysis
Function Point AnalysisFunction Point Analysis
Function Point Analysis
 
Spiral model
Spiral modelSpiral model
Spiral model
 
Process Improvement in Software Engineering SE25
Process Improvement in Software Engineering SE25Process Improvement in Software Engineering SE25
Process Improvement in Software Engineering SE25
 
Chapter 7 software reliability
Chapter 7 software reliabilityChapter 7 software reliability
Chapter 7 software reliability
 
Software Evolution
Software EvolutionSoftware Evolution
Software Evolution
 
Software Metrics - Software Engineering
Software Metrics - Software EngineeringSoftware Metrics - Software Engineering
Software Metrics - Software Engineering
 
Introduction To Software Configuration Management
Introduction To Software Configuration ManagementIntroduction To Software Configuration Management
Introduction To Software Configuration Management
 

Similar to Software maintenance and configuration management, software engineering

Unit 6 Software Configuration Management
Unit 6 Software Configuration ManagementUnit 6 Software Configuration Management
Unit 6 Software Configuration Management
KanchanPatil34
 
Fa10 mcs-005
Fa10 mcs-005Fa10 mcs-005
Fa10 mcs-005
Danish Nauman
 
Software Configuration Management.pptx
Software Configuration Management.pptxSoftware Configuration Management.pptx
Software Configuration Management.pptx
ShanmugapriyaSenthil3
 
Software Configuration Management
Software Configuration ManagementSoftware Configuration Management
Software Configuration Management
Pratik Tandel
 
Software Configuration Management.pptx
Software Configuration Management.pptxSoftware Configuration Management.pptx
Software Configuration Management.pptx
MaSheilaMagboo
 
Software Configuration Management (SCM)
Software Configuration Management (SCM)Software Configuration Management (SCM)
Software Configuration Management (SCM)
Nishkarsh Gupta
 
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.pptsfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
ssuser2d043c
 
Scm
ScmScm
Software Engineering (Software Configuration Management)
Software Engineering (Software Configuration Management)Software Engineering (Software Configuration Management)
Software Engineering (Software Configuration Management)
ShudipPal
 
Bse 3105 lecture 6-configuration management
Bse 3105  lecture 6-configuration managementBse 3105  lecture 6-configuration management
Bse 3105 lecture 6-configuration management
Alonzee Tash
 
Configuration Management
Configuration ManagementConfiguration Management
Configuration Management
Saqib Raza
 
Mod5-SCM.ppt
Mod5-SCM.pptMod5-SCM.ppt
Mod5-SCM.ppt
divyammo
 
Mod5-SCM.ppt
Mod5-SCM.pptMod5-SCM.ppt
Mod5-SCM.ppt
divyammo
 
Software configuration management, Web engineering
Software configuration management, Web engineeringSoftware configuration management, Web engineering
Software configuration management, Web engineering
divyammo
 
340_18CS35_se_mod1(secab).pdf
340_18CS35_se_mod1(secab).pdf340_18CS35_se_mod1(secab).pdf
340_18CS35_se_mod1(secab).pdf
krishnaraj714229
 
SE2_Lec 22_Software Configuration Management
SE2_Lec 22_Software Configuration ManagementSE2_Lec 22_Software Configuration Management
SE2_Lec 22_Software Configuration Management
Amr E. Mohamed
 
Lecture 2 (Software Processes)
Lecture 2 (Software Processes)Lecture 2 (Software Processes)
Lecture 2 (Software Processes)
Education Front
 
Configuration Management
Configuration ManagementConfiguration Management
Configuration Management
elliando dias
 
SE-Lecture-8.pptx
SE-Lecture-8.pptxSE-Lecture-8.pptx
SE-Lecture-8.pptx
vishal choudhary
 
Lecture 06 Software Configuration Management
Lecture 06 Software Configuration ManagementLecture 06 Software Configuration Management
Lecture 06 Software Configuration Management
Achmad Solichin
 

Similar to Software maintenance and configuration management, software engineering (20)

Unit 6 Software Configuration Management
Unit 6 Software Configuration ManagementUnit 6 Software Configuration Management
Unit 6 Software Configuration Management
 
Fa10 mcs-005
Fa10 mcs-005Fa10 mcs-005
Fa10 mcs-005
 
Software Configuration Management.pptx
Software Configuration Management.pptxSoftware Configuration Management.pptx
Software Configuration Management.pptx
 
Software Configuration Management
Software Configuration ManagementSoftware Configuration Management
Software Configuration Management
 
Software Configuration Management.pptx
Software Configuration Management.pptxSoftware Configuration Management.pptx
Software Configuration Management.pptx
 
Software Configuration Management (SCM)
Software Configuration Management (SCM)Software Configuration Management (SCM)
Software Configuration Management (SCM)
 
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.pptsfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
sfdgdfgfgfdgvsdfdsfedrfewsfdsfsfterfdcm.ppt
 
Scm
ScmScm
Scm
 
Software Engineering (Software Configuration Management)
Software Engineering (Software Configuration Management)Software Engineering (Software Configuration Management)
Software Engineering (Software Configuration Management)
 
Bse 3105 lecture 6-configuration management
Bse 3105  lecture 6-configuration managementBse 3105  lecture 6-configuration management
Bse 3105 lecture 6-configuration management
 
Configuration Management
Configuration ManagementConfiguration Management
Configuration Management
 
Mod5-SCM.ppt
Mod5-SCM.pptMod5-SCM.ppt
Mod5-SCM.ppt
 
Mod5-SCM.ppt
Mod5-SCM.pptMod5-SCM.ppt
Mod5-SCM.ppt
 
Software configuration management, Web engineering
Software configuration management, Web engineeringSoftware configuration management, Web engineering
Software configuration management, Web engineering
 
340_18CS35_se_mod1(secab).pdf
340_18CS35_se_mod1(secab).pdf340_18CS35_se_mod1(secab).pdf
340_18CS35_se_mod1(secab).pdf
 
SE2_Lec 22_Software Configuration Management
SE2_Lec 22_Software Configuration ManagementSE2_Lec 22_Software Configuration Management
SE2_Lec 22_Software Configuration Management
 
Lecture 2 (Software Processes)
Lecture 2 (Software Processes)Lecture 2 (Software Processes)
Lecture 2 (Software Processes)
 
Configuration Management
Configuration ManagementConfiguration Management
Configuration Management
 
SE-Lecture-8.pptx
SE-Lecture-8.pptxSE-Lecture-8.pptx
SE-Lecture-8.pptx
 
Lecture 06 Software Configuration Management
Lecture 06 Software Configuration ManagementLecture 06 Software Configuration Management
Lecture 06 Software Configuration Management
 

More from Rupesh Vaishnav

Software design, software engineering
Software design, software engineeringSoftware design, software engineering
Software design, software engineering
Rupesh Vaishnav
 
Software coding & testing, software engineering
Software coding & testing, software engineeringSoftware coding & testing, software engineering
Software coding & testing, software engineering
Rupesh Vaishnav
 
Software as a service, software engineering
Software as a service, software engineeringSoftware as a service, software engineering
Software as a service, software engineering
Rupesh Vaishnav
 
Requirement analysis and specification, software engineering
Requirement analysis and specification, software engineeringRequirement analysis and specification, software engineering
Requirement analysis and specification, software engineering
Rupesh Vaishnav
 
Quality assurance and management, software engineering
Quality assurance and management, software engineeringQuality assurance and management, software engineering
Quality assurance and management, software engineering
Rupesh Vaishnav
 
Managing software project, software engineering
Managing software project, software engineeringManaging software project, software engineering
Managing software project, software engineering
Rupesh Vaishnav
 
Intoduction to software engineering part 2
Intoduction to software engineering part 2Intoduction to software engineering part 2
Intoduction to software engineering part 2
Rupesh Vaishnav
 
Intoduction to software engineering part 1
Intoduction to software engineering part 1Intoduction to software engineering part 1
Intoduction to software engineering part 1
Rupesh Vaishnav
 
Advanced topics in software engineering
Advanced topics in software engineeringAdvanced topics in software engineering
Advanced topics in software engineering
Rupesh Vaishnav
 

More from Rupesh Vaishnav (9)

Software design, software engineering
Software design, software engineeringSoftware design, software engineering
Software design, software engineering
 
Software coding & testing, software engineering
Software coding & testing, software engineeringSoftware coding & testing, software engineering
Software coding & testing, software engineering
 
Software as a service, software engineering
Software as a service, software engineeringSoftware as a service, software engineering
Software as a service, software engineering
 
Requirement analysis and specification, software engineering
Requirement analysis and specification, software engineeringRequirement analysis and specification, software engineering
Requirement analysis and specification, software engineering
 
Quality assurance and management, software engineering
Quality assurance and management, software engineeringQuality assurance and management, software engineering
Quality assurance and management, software engineering
 
Managing software project, software engineering
Managing software project, software engineeringManaging software project, software engineering
Managing software project, software engineering
 
Intoduction to software engineering part 2
Intoduction to software engineering part 2Intoduction to software engineering part 2
Intoduction to software engineering part 2
 
Intoduction to software engineering part 1
Intoduction to software engineering part 1Intoduction to software engineering part 1
Intoduction to software engineering part 1
 
Advanced topics in software engineering
Advanced topics in software engineeringAdvanced topics in software engineering
Advanced topics in software engineering
 

Recently uploaded

Online train ticket booking system project.pdf
Online train ticket booking system project.pdfOnline train ticket booking system project.pdf
Online train ticket booking system project.pdf
Kamal Acharya
 
Call Girls Goa (india) ☎️ +91-7426014248 Goa Call Girl
Call Girls Goa (india) ☎️ +91-7426014248 Goa Call GirlCall Girls Goa (india) ☎️ +91-7426014248 Goa Call Girl
Call Girls Goa (india) ☎️ +91-7426014248 Goa Call Girl
sapna sharmap11
 
Microsoft Azure AD architecture and features
Microsoft Azure AD architecture and featuresMicrosoft Azure AD architecture and features
Microsoft Azure AD architecture and features
ssuser381403
 
Covid Management System Project Report.pdf
Covid Management System Project Report.pdfCovid Management System Project Report.pdf
Covid Management System Project Report.pdf
Kamal Acharya
 
🔥 Hyderabad Call Girls  👉 9352988975 👫 High Profile Call Girls Whatsapp Numbe...
🔥 Hyderabad Call Girls  👉 9352988975 👫 High Profile Call Girls Whatsapp Numbe...🔥 Hyderabad Call Girls  👉 9352988975 👫 High Profile Call Girls Whatsapp Numbe...
🔥 Hyderabad Call Girls  👉 9352988975 👫 High Profile Call Girls Whatsapp Numbe...
aarusi sexy model
 
Intuit CRAFT demonstration presentation for sde
Intuit CRAFT demonstration presentation for sdeIntuit CRAFT demonstration presentation for sde
Intuit CRAFT demonstration presentation for sde
ShivangMishra54
 
Call Girls Nagpur 8824825030 Escort In Nagpur service 24X7
Call Girls Nagpur 8824825030 Escort In Nagpur service 24X7Call Girls Nagpur 8824825030 Escort In Nagpur service 24X7
Call Girls Nagpur 8824825030 Escort In Nagpur service 24X7
sexytaniya455
 
Update 40 models( Solar Cell ) in SPICE PARK(JUL2024)
Update 40 models( Solar Cell ) in SPICE PARK(JUL2024)Update 40 models( Solar Cell ) in SPICE PARK(JUL2024)
Update 40 models( Solar Cell ) in SPICE PARK(JUL2024)
Tsuyoshi Horigome
 
INTRODUCTION TO ARTIFICIAL INTELLIGENCE BASIC
INTRODUCTION TO ARTIFICIAL INTELLIGENCE BASICINTRODUCTION TO ARTIFICIAL INTELLIGENCE BASIC
INTRODUCTION TO ARTIFICIAL INTELLIGENCE BASIC
GOKULKANNANMMECLECTC
 
Call Girls In Lucknow 🔥 +91-7014168258🔥High Profile Call Girl Lucknow
Call Girls In Lucknow 🔥 +91-7014168258🔥High Profile Call Girl LucknowCall Girls In Lucknow 🔥 +91-7014168258🔥High Profile Call Girl Lucknow
Call Girls In Lucknow 🔥 +91-7014168258🔥High Profile Call Girl Lucknow
yogita singh$A17
 
MODULE 5 BIOLOGY FOR ENGINEERS TRENDS IN BIO ENGINEERING.pptx
MODULE 5 BIOLOGY FOR ENGINEERS TRENDS IN BIO ENGINEERING.pptxMODULE 5 BIOLOGY FOR ENGINEERS TRENDS IN BIO ENGINEERING.pptx
MODULE 5 BIOLOGY FOR ENGINEERS TRENDS IN BIO ENGINEERING.pptx
NaveenNaveen726446
 
Lateral load-resisting systems in buildings.pptx
Lateral load-resisting systems in buildings.pptxLateral load-resisting systems in buildings.pptx
Lateral load-resisting systems in buildings.pptx
DebendraDevKhanal1
 
Asymmetrical Repulsion Magnet Motor Ratio 6-7.pdf
Asymmetrical Repulsion Magnet Motor Ratio 6-7.pdfAsymmetrical Repulsion Magnet Motor Ratio 6-7.pdf
Asymmetrical Repulsion Magnet Motor Ratio 6-7.pdf
felixwold
 
🔥Young College Call Girls Chandigarh 💯Call Us 🔝 7737669865 🔝💃Independent Chan...
🔥Young College Call Girls Chandigarh 💯Call Us 🔝 7737669865 🔝💃Independent Chan...🔥Young College Call Girls Chandigarh 💯Call Us 🔝 7737669865 🔝💃Independent Chan...
🔥Young College Call Girls Chandigarh 💯Call Us 🔝 7737669865 🔝💃Independent Chan...
sonamrawat5631
 
一比一原版(UO毕业证)渥太华大学毕业证如何办理
一比一原版(UO毕业证)渥太华大学毕业证如何办理一比一原版(UO毕业证)渥太华大学毕业证如何办理
一比一原版(UO毕业证)渥太华大学毕业证如何办理
gapboxn
 
Better Builder Magazine, Issue 49 / Spring 2024
Better Builder Magazine, Issue 49 / Spring 2024Better Builder Magazine, Issue 49 / Spring 2024
Better Builder Magazine, Issue 49 / Spring 2024
Better Builder Magazine
 
❣Unsatisfied Bhabhi Call Girls Surat 💯Call Us 🔝 7014168258 🔝💃Independent Sura...
❣Unsatisfied Bhabhi Call Girls Surat 💯Call Us 🔝 7014168258 🔝💃Independent Sura...❣Unsatisfied Bhabhi Call Girls Surat 💯Call Us 🔝 7014168258 🔝💃Independent Sura...
❣Unsatisfied Bhabhi Call Girls Surat 💯Call Us 🔝 7014168258 🔝💃Independent Sura...
hotchicksescort
 
paper relate Chozhavendhan et al. 2020.pdf
paper relate Chozhavendhan et al. 2020.pdfpaper relate Chozhavendhan et al. 2020.pdf
paper relate Chozhavendhan et al. 2020.pdf
ShurooqTaib
 
SPICE PARK JUL2024 ( 6,866 SPICE Models )
SPICE PARK JUL2024 ( 6,866 SPICE Models )SPICE PARK JUL2024 ( 6,866 SPICE Models )
SPICE PARK JUL2024 ( 6,866 SPICE Models )
Tsuyoshi Horigome
 
College Call Girls Kolkata 🔥 7014168258 🔥 Real Fun With Sexual Girl Available...
College Call Girls Kolkata 🔥 7014168258 🔥 Real Fun With Sexual Girl Available...College Call Girls Kolkata 🔥 7014168258 🔥 Real Fun With Sexual Girl Available...
College Call Girls Kolkata 🔥 7014168258 🔥 Real Fun With Sexual Girl Available...
Ak47
 

Recently uploaded (20)

Online train ticket booking system project.pdf
Online train ticket booking system project.pdfOnline train ticket booking system project.pdf
Online train ticket booking system project.pdf
 
Call Girls Goa (india) ☎️ +91-7426014248 Goa Call Girl
Call Girls Goa (india) ☎️ +91-7426014248 Goa Call GirlCall Girls Goa (india) ☎️ +91-7426014248 Goa Call Girl
Call Girls Goa (india) ☎️ +91-7426014248 Goa Call Girl
 
Microsoft Azure AD architecture and features
Microsoft Azure AD architecture and featuresMicrosoft Azure AD architecture and features
Microsoft Azure AD architecture and features
 
Covid Management System Project Report.pdf
Covid Management System Project Report.pdfCovid Management System Project Report.pdf
Covid Management System Project Report.pdf
 
🔥 Hyderabad Call Girls  👉 9352988975 👫 High Profile Call Girls Whatsapp Numbe...
🔥 Hyderabad Call Girls  👉 9352988975 👫 High Profile Call Girls Whatsapp Numbe...🔥 Hyderabad Call Girls  👉 9352988975 👫 High Profile Call Girls Whatsapp Numbe...
🔥 Hyderabad Call Girls  👉 9352988975 👫 High Profile Call Girls Whatsapp Numbe...
 
Intuit CRAFT demonstration presentation for sde
Intuit CRAFT demonstration presentation for sdeIntuit CRAFT demonstration presentation for sde
Intuit CRAFT demonstration presentation for sde
 
Call Girls Nagpur 8824825030 Escort In Nagpur service 24X7
Call Girls Nagpur 8824825030 Escort In Nagpur service 24X7Call Girls Nagpur 8824825030 Escort In Nagpur service 24X7
Call Girls Nagpur 8824825030 Escort In Nagpur service 24X7
 
Update 40 models( Solar Cell ) in SPICE PARK(JUL2024)
Update 40 models( Solar Cell ) in SPICE PARK(JUL2024)Update 40 models( Solar Cell ) in SPICE PARK(JUL2024)
Update 40 models( Solar Cell ) in SPICE PARK(JUL2024)
 
INTRODUCTION TO ARTIFICIAL INTELLIGENCE BASIC
INTRODUCTION TO ARTIFICIAL INTELLIGENCE BASICINTRODUCTION TO ARTIFICIAL INTELLIGENCE BASIC
INTRODUCTION TO ARTIFICIAL INTELLIGENCE BASIC
 
Call Girls In Lucknow 🔥 +91-7014168258🔥High Profile Call Girl Lucknow
Call Girls In Lucknow 🔥 +91-7014168258🔥High Profile Call Girl LucknowCall Girls In Lucknow 🔥 +91-7014168258🔥High Profile Call Girl Lucknow
Call Girls In Lucknow 🔥 +91-7014168258🔥High Profile Call Girl Lucknow
 
MODULE 5 BIOLOGY FOR ENGINEERS TRENDS IN BIO ENGINEERING.pptx
MODULE 5 BIOLOGY FOR ENGINEERS TRENDS IN BIO ENGINEERING.pptxMODULE 5 BIOLOGY FOR ENGINEERS TRENDS IN BIO ENGINEERING.pptx
MODULE 5 BIOLOGY FOR ENGINEERS TRENDS IN BIO ENGINEERING.pptx
 
Lateral load-resisting systems in buildings.pptx
Lateral load-resisting systems in buildings.pptxLateral load-resisting systems in buildings.pptx
Lateral load-resisting systems in buildings.pptx
 
Asymmetrical Repulsion Magnet Motor Ratio 6-7.pdf
Asymmetrical Repulsion Magnet Motor Ratio 6-7.pdfAsymmetrical Repulsion Magnet Motor Ratio 6-7.pdf
Asymmetrical Repulsion Magnet Motor Ratio 6-7.pdf
 
🔥Young College Call Girls Chandigarh 💯Call Us 🔝 7737669865 🔝💃Independent Chan...
🔥Young College Call Girls Chandigarh 💯Call Us 🔝 7737669865 🔝💃Independent Chan...🔥Young College Call Girls Chandigarh 💯Call Us 🔝 7737669865 🔝💃Independent Chan...
🔥Young College Call Girls Chandigarh 💯Call Us 🔝 7737669865 🔝💃Independent Chan...
 
一比一原版(UO毕业证)渥太华大学毕业证如何办理
一比一原版(UO毕业证)渥太华大学毕业证如何办理一比一原版(UO毕业证)渥太华大学毕业证如何办理
一比一原版(UO毕业证)渥太华大学毕业证如何办理
 
Better Builder Magazine, Issue 49 / Spring 2024
Better Builder Magazine, Issue 49 / Spring 2024Better Builder Magazine, Issue 49 / Spring 2024
Better Builder Magazine, Issue 49 / Spring 2024
 
❣Unsatisfied Bhabhi Call Girls Surat 💯Call Us 🔝 7014168258 🔝💃Independent Sura...
❣Unsatisfied Bhabhi Call Girls Surat 💯Call Us 🔝 7014168258 🔝💃Independent Sura...❣Unsatisfied Bhabhi Call Girls Surat 💯Call Us 🔝 7014168258 🔝💃Independent Sura...
❣Unsatisfied Bhabhi Call Girls Surat 💯Call Us 🔝 7014168258 🔝💃Independent Sura...
 
paper relate Chozhavendhan et al. 2020.pdf
paper relate Chozhavendhan et al. 2020.pdfpaper relate Chozhavendhan et al. 2020.pdf
paper relate Chozhavendhan et al. 2020.pdf
 
SPICE PARK JUL2024 ( 6,866 SPICE Models )
SPICE PARK JUL2024 ( 6,866 SPICE Models )SPICE PARK JUL2024 ( 6,866 SPICE Models )
SPICE PARK JUL2024 ( 6,866 SPICE Models )
 
College Call Girls Kolkata 🔥 7014168258 🔥 Real Fun With Sexual Girl Available...
College Call Girls Kolkata 🔥 7014168258 🔥 Real Fun With Sexual Girl Available...College Call Girls Kolkata 🔥 7014168258 🔥 Real Fun With Sexual Girl Available...
College Call Girls Kolkata 🔥 7014168258 🔥 Real Fun With Sexual Girl Available...
 

Software maintenance and configuration management, software engineering

  • 2. Types of Maintenance •Corrective Maintenance (21%) • making changes to repair defects •Adaptive Maintenance (25%) • making changes to adapt software to external environment changes (hardware, business rules, OS, etc.) •Perfective Maintenance (50%) • extending system beyond its original functional requirements •Preventative Maintenance (4%) • modifying work products so that they are more easily corrected, adapted, or enhanced
  • 3. Maintenance Costs •Usually greater than the development costs (2 to 10 times as much in some cases) •Affected by both technical and non-technical factors •Increase as software is maintained and system corruption is introduced •Aging software can have high support costs (e.g. old languages, compilers, etc.)
  • 4. Maintenance Developer Tasks • Understand system. • Locate information in documentation. • Keep system documentation up to date. • Extend existing functions. • Add new functions. • Find sources of errors. • Correct system errors. • Answer operations questions. • Restructure design and code. • Delete obsolete design and code. • Manage changes.
  • 5. Maintenance Cost Factors •Staff turnover • no turnover usually means lower maintenance costs •Contractual responsibility • developers may have no contractual obligation to maintain the delivered system and no incentive to design for future change •Staff skills • maintenance staff are often inexperienced and have limited domain knowledge •Program age and structure • as programs age their structure deteriorates, they become harder to understand and change
  • 6. Maintenance Prediction •Concerned with determining which parts of the system may cause problems and have high maintenance costs •Change acceptance depends on the maintainability of the components affected by the change •Implementing changes degrade system and reduces its maintainability •Maintenance costs depends on number of changes
  • 7. Configuration Management •Software changes are inevitable •One goal of software engineering is to improve how easy it is to change software •Configuration management is all about change control. •Every software engineer has to be concerned with how changes made to work products are tracked and propagated throughout a project. •To ensure quality is maintained the change process must be audited.
  • 8. Configuration Management Definition: The set of activities that have been developed to manage change throughout the software life cycle. Purpose: Systematically control changes to the configuration and maintain the integrity and traceability of the configuration throughout the system’s life cycle.
  • 9. Purpose of CM • Identify Change • Control Change • Ensure Change is Properly Implemented • Report Changes to All the people who need to Know
  • 10. Baseline •Definition: Specification or product that • has been formally reviewed and agreed upon, • serves as the basis for further development, and • can be changed only through formal change control procedures. •Signals a point of departure from one activity to the start of another activity. •Helps control change without impeding justifiable change.
  • 11. Project Baseline •Central repository of reviewed and approved artifacts that represent a given stable point in overall system development. •Shared DB for project and kept in consistent state. •Policies allow the team to achieve consistent state and manage the project.
  • 12. Software Configuration Item (SCI) •Definition: Information that is created as part of the software engineering process. •Examples: •Software Project Plan •Software Requirements Specification • Models, Prototypes, Requirements •Design document • Protocols, Hierarchy Graphs •Source code • Modules •Test suite •Software tools (e.g., compilers)
  • 13. Elements of SCM There are four elements of SCM: 1. Software Configuration Identification 2. Software Configuration Control 3. Software Configuration Auditing 4. Software Configuration Status Accounting
  • 14. SCM Tasks •Identification •Change control •Version control •Configuration auditing •Status reporting
  • 15. Identification Task • Identification separately names each CSCI and then organizes it in the SCM repository using an object-oriented approach • Objects start out as basic objects and are then grouped into aggregate objects • Each object has a set of distinct features that identify it • A name that is unambiguous to all other objects • A description that contains the CSCI type, a project identifier, and change and/or version information • List of resources needed by the object • The object realization (i.e., the document, the file, the model, etc.)
  • 16. Change Control Task • Change control is a procedural activity that ensures quality and consistency as changes are made to a configuration object • A change request is submitted to a configuration control authority, which is usually a change control board (CCB) • The request is evaluated for technical merit, potential side effects, overall impact on other configuration objects and system functions, and projected cost in terms of money, time, and resources • An engineering change order (ECO) is issued for each approved change request • Describes the change to be made, the constraints to follow, and the criteria for review and audit • The baselined CSCI is obtained from the SCM repository • Access control governs which software engineers have the authority to access and modify a particular configuration object • Synchronization control helps to ensure that parallel changes performed by two different people don't overwrite one another
  • 17. Version Control Task • Version control is a set of procedures and tools for managing the creation and use of multiple occurrences of objects in the SCM repository • Required version control capabilities • An SCM repository that stores all relevant configuration objects • A version management capability that stores all versions of a configuration object (or enables any version to be constructed using differences from past versions) • A make facility that enables the software engineer to collect all relevant configuration objects and construct a specific version of the software • Issues tracking (bug tracking) capability that enables the team to record and track the status of all outstanding issues associated with each configuration object • The SCM repository maintains a change set • Serves as a collection of all changes made to a baseline configuration • Used to create a specific version of the software • Captures all changes to all files in the configuration along with the reason for changes and details of who made the changes and when
  • 18. Configuration Auditing Task • Configuration auditing is an SQA activity that helps to ensure that quality is maintained as changes are made • It complements the formal technical review and is conducted by the SQA group • It addresses the following questions • Has a formal technical review been conducted to assess technical correctness? • Has the software process been followed, and have software engineering standards been properly applied? • Has the change been "highlighted" and "documented" in the CSCI? Have the change data and change author been specified? Do the attributes of the configuration object reflect the change? • Have SCM procedures for noting the change, recording it, and reporting it been followed? • Have all related CSCIs been properly updated? • A configuration audit ensures that • The correct CSCIs (by version) have been incorporated into a specific build • That all documentation is up-to-date and consistent with the version that has been built
  • 19. Status Reporting Task • Configuration status reporting (CSR) is also called status accounting • Provides information about each change to those personnel in an organization with a need to know • Answers what happened, who did it, when did it happen, and what else will be affected? • Sources of entries for configuration status reporting • Each time a CSCI is assigned new or updated information • Each time a configuration audit is conducted • The configuration status report • Placed in an on-line database or on a website for software developers and maintainers to read • Given to management and practitioners to keep them appraised of important changes to the project CSCIs
  翻译: